Cusabio Human Recombinants
Recombinant Human Small muscular protein (SMPX) | CSB-EP887043HU
- SKU:
- CSB-EP887043HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Small muscular protein (SMPX) | CSB-EP887043HU | Cusabio
Alternative Name(s): Stretch-responsive skeletal muscle protein
Gene Names: SMPX
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-88aa
Sequence Info: Full Length
MW: 36.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.
Reference: "Identification of a novel stretch-responsive skeletal muscle gene (Smpx)." Kemp T.J., Sadusky T.J., Simon M., Brown R., Eastwood M., Sassoon D.A., Coulton G.R. Genomics 72:260-271(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.
Involvement in disease: Deafness, X-linked, 4 (DFNX4)
Subcellular Location:
Protein Families: SMPX family
Tissue Specificity: Preferentially and abundantly expressed in heart and skeletal muscle.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9UHP9
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM