Recombinant Human Small muscular protein (SMPX) | CSB-EP887043HU

(No reviews yet) Write a Review
SKU:
CSB-EP887043HU
Availability:
13 - 23 Working Days
  • Recombinant Human Small muscular protein (SMPX)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Human Small muscular protein (SMPX) | CSB-EP887043HU | Cusabio

Alternative Name(s): Stretch-responsive skeletal muscle protein

Gene Names: SMPX

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-88aa

Sequence Info: Full Length

MW: 36.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

Reference: "Identification of a novel stretch-responsive skeletal muscle gene (Smpx)." Kemp T.J., Sadusky T.J., Simon M., Brown R., Eastwood M., Sassoon D.A., Coulton G.R. Genomics 72:260-271(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

Involvement in disease: Deafness, X-linked, 4 (DFNX4)

Subcellular Location:

Protein Families: SMPX family

Tissue Specificity: Preferentially and abundantly expressed in heart and skeletal muscle.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UHP9

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose