Recombinant human Seryl-tRNA synthetase, Cytoplasmic domain protein (SERS), partial | CSB-EP020709HU1

Recombinant human Seryl-tRNA synthetase, Cytoplasmic domain protein (SERS), partial | CSB-EP020709HU1 | Cusabio

Alternative Name(s): Seryl-tRNA synthetase ;SerRSSeryl-tRNA(Ser/Sec) synthetase

Gene Names: SERS

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEV

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-233aa

Sequence Info: Partial

MW: 53.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec).

Reference: Genomic organization, cDNA sequence, bacterial expression, and purification of human seryl-tRNA synthase.Vincent C., Tarbouriech N., Haertlein M.Eur. J. Biochem. 250:77-84(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the attachment of serine to tRNA(Ser) in a two-step reaction

Involvement in disease: Neurodevelopmental disorder with microcephaly, ataxia, and seizures (NEDMAS)

Subcellular Location: Cytoplasm, Nucleus

Protein Families: Class-II aminoacyl-tRNA synthetase family, Type-1 seryl-tRNA synthetase subfamily

Tissue Specificity: Brain.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P49591

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM