Recombinant Human Selenoprotein M (SELM) | CSB-EP837868HUe1

Recombinant Human Selenoprotein M (SELM) | CSB-EP837868HUe1 | Cusabio

Alternative Name(s): SELENOM; SELM; Selenoprotein M; SelM

Gene Names: SELM

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL

Source: E.coli

Tag Info: Tag-Free

Expression Region: 24-145aa

Sequence Info: Full Length of Mature Protein

MW: 13.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.

Reference: "Mammalian selenoprotein in which selenocysteine (Sec) incorporation is supported by a new form of Sec insertion sequence element." Korotkov K.V., Novoselov S.V., Hatfield D.L., Gladyshev V.N. Mol. Cell. Biol. 22:1402-1411(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.

Involvement in disease:

Subcellular Location: Cytoplasm, perinuclear region, Endoplasmic reticulum, Golgi apparatus

Protein Families: Selenoprotein M/F family

Tissue Specificity: Widely expressed.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8WWX9

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM