Cusabio Active Proteins
Recombinant Human Secreted and transmembrane protein 1 (SECTM1), partial (Active) | CSB-MP819898HU
- SKU:
 - CSB-MP819898HU
 - Availability:
 - 3 to 7 Working Days
 
Description
Recombinant Human Secreted and transmembrane protein 1 (SECTM1) ,partial (Active) | CSB-MP819898HU | Cusabio
Protein Description: Partial
Alternative Name (s) : (Protein K-12) (K12)
Gene Names: SECTM1
Research Areas: Cancer
Species: Homo sapiens (Human)
Source: Mammalian cell
Tag Info: C-terminal hFc-tagged
Expression Region: 29-145aa
Sequence Info: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG
Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized CD7 (CSB-MP004953HU) at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.
MW: 41.6 kDa
Purity: Greater than 92% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
Relevance: May be involved in thymocyte signaling.
PubMed ID:
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q8WVN6
Uniprot Entry Name:
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A