Recombinant Human Ropporin-1B (ROPN1B), partial | CSB-EP020065HU

(No reviews yet) Write a Review
SKU:
CSB-EP020065HU
Availability:
13 - 23 Working Days
  • Recombinant Human Ropporin-1B (ROPN1B), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Ropporin-1B (ROPN1B), partial | CSB-EP020065HU | Cusabio

Alternative Name(s): Rhophilin-associated protein 1B

Gene Names: ROPN1B

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-120aa

Sequence Info: Partial of Isoform 2

MW: 40.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA.Carr D.W., Fujita A., Stentz C.L., Liberty G.A., Olson G.E., Narumiya S.J. Biol. Chem. 276:17332-17338(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.

Involvement in disease:

Subcellular Location: Cell projection, cilium, flagellum

Protein Families: Ropporin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BZX4

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose