Recombinant Human Ribonuclease 4 (RNASE4) | CSB-BP019796HU

(No reviews yet) Write a Review
SKU:
CSB-BP019796HU
Availability:
28 - 38 Working Days
  • Recombinant Human Ribonuclease 4 (RNASE4)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€443.00 - €2,021.00

Description

Recombinant Human Ribonuclease 4 (RNASE4) | CSB-BP019796HU | Cusabio

Alternative Name(s): RNS4

Gene Names: RNASE4

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG

Source: Baculovirus

Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-tagged

Expression Region: 29-147aa

Sequence Info: Full Length of Mature Protein

MW: 57.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: This RNase has marked specificity towards the 3' side of uridine nucleotides.

Reference: "Human ribonuclease 4 (RNase 4): coding sequence, chromosomal localization and identification of two distinct transcripts in human somatic tissues." Rosenberg H.F., Dyer K.D. Nucleic Acids Res. 23:4290-4295(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This RNase has marked specificity towards the 3' side of uridine nucleotides.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Pancreatic ribonuclease family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P34096

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose