Cusabio Human Recombinants
Recombinant Human Ras-related protein Rab-3C (RAB3C) | CSB-EP846609HU
- SKU:
- CSB-EP846609HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Ras-related protein Rab-3C (RAB3C) | CSB-EP846609HU | Cusabio
Alternative Name(s): RAB3C; RAB3C member RAS oncogene family; RAB3C_HUMAN; Ras related protein Rab3C; Ras-related protein Rab-3C
Gene Names: RAB3C
Research Areas: Transport
Organism: Homo sapiens (Human)
AA Sequence: MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-227aa
Sequence Info: Full Length
MW: 42 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Protein transport. Probably involved in vesicular traffic .
Reference: Cloning, mapping, and characterization of the human Rab3C gene.Cheng H., Ma Y., Ni X., Jiang M., Luo Y., Ying K., Xie Y., Ma Y.Biochem. Genet. 40:263-272(2002)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Protein transport. Probably involved in vesicular traffic (By similarity).
Involvement in disease:
Subcellular Location: Cell membrane, Lipid-anchor, Cytoplasmic side
Protein Families: Small GTPase superfamily, Rab family
Tissue Specificity: Expressed in brain, placenta and lung.
Paythway: Excitatorysynapsepathway
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q96E17
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM