Cusabio Human Recombinants
Recombinant Human Protein FAM167A (FAM167A) | CSB-MP836244HU
- SKU:
- CSB-MP836244HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Protein FAM167A (FAM167A) | CSB-MP836244HU | Cusabio
Alternative Name(s): FAM167A; C8orf13Protein FAM167A
Gene Names: FAM167A
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC
Source: Mammalian cell
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-214aa
Sequence Info: Full Length
MW: 28.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "Physical and transcriptional map of the critical region for keratolytic winter erythema (KWE) on chromosome 8p22-p23 between D8S550 and D8S1759." Appel S., Filter M., Reis A., Hennies H.C., Bergheim A., Ogilvie E., Arndt S., Simmons A., Lovett M., Hide W., Ramsay M., Reichwald K., Zimmermann W., Rosenthal A. Eur. J. Hum. Genet. 10:17-25(2002)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families: FAM167 (SEC) family
Tissue Specificity: Expressed in skin, including primary keratinocytes, spleen, kidney, leukocytes, testis, lung, small intestine and prostate.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q96KS9
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM