Recombinant Human Protein delta homolog 1 (DLK1), partial | CSB-EP006945HU

(No reviews yet) Write a Review
SKU:
CSB-EP006945HU
Availability:
3 - 7 Working Days
  • Recombinant Human Protein delta homolog 1 (DLK1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Protein delta homolog 1 (DLK1), partial | CSB-EP006945HU | Cusabio

Alternative Name(s): pG2

Gene Names: DLK1

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-303aa

Sequence Info: Partial

MW: 33.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May have a role in neuroendocrine differentiation.

Reference: Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD.Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G.Mol. Cell. Proteomics 0:0-0(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May have a role in neuroendocrine differentiation.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in some forms of neuroendocrine lung tumor tissue.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P80370

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose