Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial | CSB-YP014597HU

Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial | CSB-YP014597HU | Cusabio

Alternative Name(s): Antigen identified by monoclonal Ki 67 ; Antigen identified by monoclonal Ki-67; Antigen KI-67; Antigen KI67 ; Antigen Ki67; KI67_HUMAN; KIA; Marker of proliferation Ki-67; MIB 1; MIB; MKI67; PPP1R105; Proliferation marker protein Ki-67; Proliferation related Ki 67 antigen ; Protein phosphatase 1 regulatory subunit 105; RP11-380J17.2

Gene Names: MKI67

Research Areas: Cell Cycle

Organism: Homo sapiens (Human)

AA Sequence: NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 3120-3256aa

Sequence Info: Partial

MW: 17.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Thought to be required for maintaining cell proliferation.

Reference: A novel nucleolar protein, NIFK, interacts with the forkhead associated domain of Ki-67 antigen in mitosis.Takagi M., Sueishi M., Saiwaki T., Kametaka A., Yoneda Y.J. Biol. Chem. 276:25386-25391(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly

Involvement in disease:

Subcellular Location: Chromosome, Nucleus, Nucleus, nucleolus

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P46013

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM