Recombinant Human Prolactin-inducible protein (PIP) | CSB-YP018020HU

(No reviews yet) Write a Review
SKU:
CSB-YP018020HU
Availability:
25 - 35 Working Days
  • Recombinant Human Prolactin-inducible protein (PIP)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€262.00 - €943.00

Description

Recombinant Human Prolactin-inducible protein (PIP) | CSB-YP018020HU | Cusabio

Alternative Name(s): Gross cystic disease fluid protein 15

Gene Names: PIP

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE

Source: Yeast

Tag Info: N-terminal 10xHis-tagged

Expression Region: 29-146aa

Sequence Info: Full Length of Mature Protein

MW: 16 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "The prolactin-inducible protein (PIP/GCDFP-15) gene: cloning, structure and regulation." Myal Y., Iwasiow B., Tsuyuki D., Wong P., Shiu R.P.C. Mol. Cell. Endocrinol. 80:165-175(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families: PIP family

Tissue Specificity: Expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary, and sweat glands.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P12273

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose