Recombinant Human Pro-glucagon (GCG), partial | CSB-YP009315HU

(No reviews yet) Write a Review
SKU:
CSB-YP009315HU
Availability:
3 - 7 Working Days
  • Recombinant Human Pro-glucagon (GCG), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€262.00 - €943.00

Description

Recombinant Human Pro-glucagon (GCG), partial | CSB-YP009315HU | Cusabio

Alternative Name(s): Incretin hormoneGlucagon-like peptide 1(7-37) ;GLP-1(7-37)Glucagon-like peptide 1(7-36) ;GLP-1(7-36)Glucagon-like peptide 2 ;GLP-2

Gene Names: GCG

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 53-89aa

Sequence Info: Partial

MW: 6.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycia. Plays an important role in initiating and maintaining hyperglycic conditions in diabetes.GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation. Inhibits beta cell apoptosis.GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.Oxyntomodulin significantly reduces food intake. Inhibits gastric ptying in humans. Suppression of gastric ptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.

Reference: Glucagon gene expression in vertebrate brain.Drucker D.J., Asa S.J. Biol. Chem. 263:13475-13478(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.; FUNCTION

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Glucagon family

Tissue Specificity: Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP-1 and GLP-2 are also secreted in selected neurons in the brain.

Paythway: Glucagonsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01275

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose