Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial | CSB-YP002343HU

Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial | CSB-YP002343HU | Cusabio

Alternative Name(s): Gastric H(+)/K(+) ATPase subunit betaProton pump beta chain

Gene Names: ATP4B

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 58-291aa

Sequence Info: Extracellular Domain

MW: 28.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.

Reference: cDNA cloning of the beta-subunit of the human gastric H,K-ATPase.Ma J.-Y., Song Y.-H., Sjoestrand S.E., Rask L., Maardh S.Biochem. Biophys. Res. Commun. 180:39-45(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type II membrane protein

Protein Families: X(+)/potassium ATPases subunit beta family

Tissue Specificity:

Paythway: OxidativePhosphorylation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P51164

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM