Recombinant Human Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP) | CSB-YP867114HU

(No reviews yet) Write a Review
SKU:
CSB-YP867114HU
Availability:
25 - 35 Working Days
  • Recombinant Human Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,135.00

Description

Recombinant Human Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP) | CSB-YP867114HU | Cusabio

Alternative Name(s): FLJ44846; FLJ46044; HDHD2B; hLHPP; lhpp; LHPP_HUMAN; Phospholysine phosphohistidine inorganic pyrophosphate phosphatase

Gene Names: LHPP

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-270aa

Sequence Info: Full Length

MW: 31.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency (By similarity)

Reference: "Molecular cloning of a cDNA for the human phospholysine phosphohistidine inorganic pyrophosphate phosphatase."Yokoi F., Hiraishi H., Izuhara K.J. Biochem. 133:607-614(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency (By similarity).

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus

Protein Families: HAD-like hydrolase superfamily

Tissue Specificity: Expressed in brain, and at lower levels in liver and kidney. Detected in thyroid (at protein level). Expressed in liver, kidney and moderately in brain.

Paythway: OxidativePhosphorylation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9H008

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose