Recombinant Human Peptide YY (PYY), partial | CSB-YP019128HU1

Recombinant Human Peptide YY (PYY), partial | CSB-YP019128HU1 | Cusabio

Alternative Name(s): PYY-I (PYY)

Gene Names: PYY

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 31-64aa

Sequence Info: Partial

MW: 6.1

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Reference: "A new molecular form of PYY: structural characterization of human PYY(3-36) and PYY(1-36)." Eberlein G.A., Eysselein V.E., Schaeffer M., Layer P., Grandt D., Goebell H., Niebel W., Davis M., Lee T.D., Shively J.E., Reeve J.R. Jr. Peptides 10:797-803(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P10082

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A