Recombinant Human Peptide YY (PYY), partial | CSB-EP019128HU1a0

(No reviews yet) Write a Review
SKU:
CSB-EP019128HU1a0
Availability:
13 - 23 Working Days
  • Recombinant Human Peptide YY (PYY), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Peptide YY (PYY), partial | CSB-EP019128HU1a0 | Cusabio

Alternative Name(s): PYY-I

Gene Names: PYY

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 31-64aa

Sequence Info: Partial

MW: 8.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Reference: Neuropeptide Y, B-type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein-alpha.Keane F.M., Nadvi N.A., Yao T.W., Gorrell M.D.FEBS J. 278:1316-1332(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: NPY family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P10082

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose