Recombinant Human PDZ domain-containing protein 11 (PDZD11) | CSB-EP707840HU

Recombinant Human PDZ domain-containing protein 11 (PDZD11) | CSB-EP707840HU | Cusabio

Alternative Name(s): ATPase-interacting PDZ protein;Plasma membrane calcium ATPase-interacting single-PDZ protein ;PMCA-interacting single-PDZ protein

Gene Names: PDZD11

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-140aa

Sequence Info: Full Length

MW: 32.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. , Gu J., Chen S.-J., Chen Z.Genome Res. 10:1546-1560(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 1: Cytoplasm

Protein Families:

Tissue Specificity: Widely expressed (at protein level).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q5EBL8

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM