Recombinant Human p53 apoptosis effector related to PMP-22 (PERP) | CSB-CF839325HU

Recombinant Human p53 apoptosis effector related to PMP-22 (PERP) | CSB-CF839325HU | Cusabio

Alternative Name(s): Keratinocyte-associated protein 1

Gene Names: PERP

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-193aa

Sequence Info: Full Length

MW: 41.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway

Reference: "p53 regulates the expression of a novel four transmembrane protein --PERP/PIGPC1 in mouse and human prostate cancer." Goltsov A.A., Ren C., Wang J., Yang G., Tahir S., Li L., Timme T.L., Thompson T.C. Submitted (OCT-2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway (By similarity).

Involvement in disease:

Subcellular Location: Cell junction, desmosome, Cell membrane, Multi-pass membrane protein

Protein Families: TMEM47 family

Tissue Specificity: Expressed in skin, heart, placental, liver, pancreas, keratinocytes and dermal fibroblasts.

Paythway: p53signalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96FX8

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM