Recombinant Human Odorant-binding protein 2a (OBP2A) | CSB-EP873688HU

(No reviews yet) Write a Review
SKU:
CSB-EP873688HU
Availability:
3 - 7 Working Days
  • Recombinant Human Odorant-binding protein 2a (OBP2A)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Odorant-binding protein 2a (OBP2A) | CSB-EP873688HU | Cusabio

Alternative Name(s): Odorant-binding protein IIa Short name:OBPIIa

Gene Names: OBP2A

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 16-170aa

Sequence Info: Full Length of Mature Protein

MW: 33.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.

Reference: "A novel human odorant-binding protein gene family resulting from genomic duplicons at 9q34: differential expression in the oral and genital spheres."Lacazette E., Gachon A.-M., Pitiot G.Hum. Mol. Genet. 9:289-301(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Calycin superfamily, Lipocalin family

Tissue Specificity: Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9NY56

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose