Cusabio Human Recombinants
Recombinant Human NK-tumor recognition protein (NKTR), partial | CSB-EP015838HU
- SKU:
- CSB-EP015838HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human NK-tumor recognition protein (NKTR), partial | CSB-EP015838HU | Cusabio
Alternative Name(s): Natural-killer cells cyclophilin-related protein 1 domains:Putative peptidyl-prolyl cis-trans isomerase (EC:5.2.1.8) ;PPIase ;Rotamase
Gene Names: NKTR
Research Areas: Cancer
Organism: Homo sapiens (Human)
AA Sequence: HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 10-175aa
Sequence Info: Partial
MW: 34.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Component of a putative tumor-recognition complex. Involved in the function of NK cells.
Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Component of a putative tumor-recognition complex. Involved in the function of NK cells.
Involvement in disease:
Subcellular Location: Membrane, Peripheral membrane protein
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P30414
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM