Recombinant Human Nectin-2 (PVRL2), partial | CSB-EP835690HU

(No reviews yet) Write a Review
SKU:
CSB-EP835690HU
Availability:
13 - 23 Working Days
  • Recombinant Human Nectin-2 (PVRL2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Nectin-2 (PVRL2), partial | CSB-EP835690HU | Cusabio

Alternative Name(s): Herpes virus entry mediator B Short name: Herpesvirus entry mediator B Short name: HveB Nectin cell adhesion molecule 2 Poliovirus receptor-related protein 2 CD_antigen: CD112

Gene Names: PVRL2

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 32-360aa

Sequence Info: Extracellular Domain

MW: 39.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Probable cell adhesion protein.

Reference: "A cell surface protein with herpesvirus entry activity (HveB) confers susceptibility to infection by mutants of herpes simplex virus type 1, herpes simplex virus type 2, and pseudorabies virus."Warner M.S., Geraghty R.J., Martinez W.M., Montgomery R.I., Whitbeck J.C., Xu R., Eisenberg R.J., Cohen G.H., Spear P.G.Virology 246:179-189(1998).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families: Nectin family

Tissue Specificity: Ubiquitous.

Paythway: Adherensjunction

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q92692

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose