Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 (NDUFS5) | CSB-RP027354h

Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 (NDUFS5) | CSB-RP027354h | Cusabio

Alternative Name(s): Complex I-15KDA ;CI-15KDANADH-ubiquinone oxidoreductase 15KDA subunit

Gene Names: NDUFS5

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: PFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-106aa

Sequence Info: Full Length of Mature Protein

MW: 39.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Reference: The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.Murray J., Zhang B., Taylor S.W., Oglesbee D., Fahy E., Marusich M.F., Ghosh S.S., Capaldi R.A.J. Biol. Chem. 278:13619-13622(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Involvement in disease:

Subcellular Location: Mitochondrion inner membrane, Peripheral membrane protein, Mitochondrion intermembrane space

Protein Families: Complex I NDUFS5 subunit family

Tissue Specificity:

Paythway: OxidativePhosphorylation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O43920

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM