Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (NDUFB7) | CSB-RP015944h

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (NDUFB7) | CSB-RP015944h | Cusabio

Alternative Name(s): Cell adhesion protein SQM1Complex I-B18 ;CI-B18NADH-ubiquinone oxidoreductase B18 subunit

Gene Names: NDUFB7

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: GAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-137aa

Sequence Info: Full Length of Mature Protein

MW: 43.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Reference: cDNA cloning of a novel cell adhesion protein expressed in human squamous carcinoma cells.Wong Y.-C., Tsao S.-W., Kakefuda M., Bernal S.D.Biochem. Biophys. Res. Commun. 166:984-992(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Involvement in disease:

Subcellular Location: Mitochondrion inner membrane, Peripheral membrane protein, Mitochondrion intermembrane space

Protein Families: Complex I NDUFB7 subunit family

Tissue Specificity:

Paythway: OxidativePhosphorylation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P17568

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM