Recombinant Human N (4) - (beta-N-acetylglucosaminyl) -L-asparaginase (AGA), partial | CSB-EP001423HU1

(No reviews yet) Write a Review
SKU:
CSB-EP001423HU1
Availability:
13 - 23 Working Days
  • Recombinant Human N (4) - (beta-N-acetylglucosaminyl) -L-asparaginase (AGA), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human N (4) - (beta-N-acetylglucosaminyl) -L-asparaginase (AGA), partial | CSB-EP001423HU1 | Cusabio

Alternative Name(s): Aspartylglucosaminidase;Glycosylasparaginase;N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase

Gene Names: AGA

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: TIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 206-346aa

Sequence Info: Partial

MW: 31.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins.

Reference: Cloning and sequence analysis of a cDNA for human glycosylasparaginase. A single gene encodes the subunits of this lysosomal amidase.Fisher K.J., Tollersrud O.-K., Aronson N.N. Jr.FEBS Lett. 269:440-444(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins.

Involvement in disease: Aspartylglucosaminuria (AGU)

Subcellular Location: Lysosome

Protein Families: Ntn-hydrolase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20933

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose