Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-A (TIMM17A) | CSB-EP023550HU

(No reviews yet) Write a Review
SKU:
CSB-EP023550HU
Availability:
13 - 23 Working Days
  • Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-A (TIMM17A)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-A (TIMM17A) | CSB-EP023550HU | Cusabio

Alternative Name(s): Inner membrane preprotein translocase Tim17a

Gene Names: TIMM17A

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-171aa

Sequence Info: Full Length

MW: 45 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Reference: "The preprotein translocase of the inner mitochondrial membrane: evolutionary conservation of targeting and assembly of Tim17." Boemer U., Rassow J., Zufall N., Pfanner N., Meijer M., Maarse A.C. J. Mol. Biol. 262:389-395(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Involvement in disease:

Subcellular Location: Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families: Tim17/Tim22/Tim23 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99595

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose