Cusabio Human Recombinants
Recombinant Human Mitochondrial import inner membrane translocase subunit TIM16 (PAM16) | CSB-EP896711HU
- SKU:
- CSB-EP896711HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Mitochondrial import inner membrane translocase subunit TIM16 (PAM16) | CSB-EP896711HU | Cusabio
Alternative Name(s): Mitochondria-associated granulocyte macrophage CSF-signaling moleculePresequence translocated-associated motor subunit PAM16
Gene Names: PAM16
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-125aa
Sequence Info: Full Length
MW: 40.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.
Reference: Identification and characterization of Magmas, a novel mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction.Jubinsky P.T., Messer A., Bender J., Morris R.E., Ciraolo G.M., Witte D.P., Hawley R.G., Short M.K.Exp. Hematol. 29:1392-1402(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.
Involvement in disease: Spondylometaphyseal dysplasia, Megarbane-Dagher-Melike type (SMDMDM)
Subcellular Location: Mitochondrion inner membrane, Peripheral membrane protein, Matrix side
Protein Families: TIM16/PAM16 family
Tissue Specificity: Ubiquitously expressed.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9Y3D7
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM