Recombinant Human Midkine (MDK) | CSB-RP105744h

(No reviews yet) Write a Review
SKU:
CSB-RP105744h
Availability:
13 - 23 Working Days
  • Recombinant Human Midkine (MDK)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Midkine (MDK) | CSB-RP105744h | Cusabio

Alternative Name(s): Amphiregulin-associated protein ;ARAPMidgestation and kidney proteinNeurite outgrowth-promoting factor 2Neurite outgrowth-promoting protein

Gene Names: MDK

Research Areas: Developmental Biology

Organism: Homo sapiens (Human)

AA Sequence: VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 21-143aa

Sequence Info: Full Length of Mature Protein

MW: 40.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Developmentally regulated, secreted growth factor homologous to pleiotrophin (PTN), which has heparin binding activity. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation. Involved in neointima formation after arterial injury, possibly by mediating leukocyte recruitment. Also involved in early fetal adrenal gland development .

Reference: Abnormal expression, highly efficient detection and novel truncations of midkine in human tumors, cancers and cell lines.Tao P., Xu D., Lin S., Ouyang G.L., Chang Y., Chen Q., Yuan Y., Zhuo X., Luo Q., Li J., Li B., Ruan L., Li Q., Li Z.Cancer Lett. 253:60-67(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Developmentally regulated, secreted growth factor homologous to pleiotrophin (PTN), which has heparin binding activity. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation. Involved in neointima formation after arterial injury, possibly by mediating leukocyte recruitment. Also involved in early fetal adrenal gland development (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Pleiotrophin family

Tissue Specificity: Expressed in various tumor cell lines. In insulinoma tissue predominantly expressed in precancerous lesions.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21741

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose