Recombinant Human Metallothionein-1F (MT1F), partial | CSB-YP015112HU

(No reviews yet) Write a Review
SKU:
CSB-YP015112HU
Availability:
25 - 35 Working Days
  • Recombinant Human Metallothionein-1F (MT1F), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€262.00 - €943.00

Description

Recombinant Human Metallothionein-1F (MT1F), partial | CSB-YP015112HU | Cusabio

Alternative Name(s): Metallothionein-IF ;MT-IF

Gene Names: MT1F

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSC

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-59aa

Sequence Info: Partial

MW: 7.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Reference: Structure and expression of the human metallothionein genes.Gedamu L., Varshney U., Jahroudi N., Foster R., Shworak N.W.Experientia Suppl. 52:361-372(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Involvement in disease:

Subcellular Location:

Protein Families: Metallothionein superfamily, Type 1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04733

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose