Recombinant Human Mannose-binding protein C (MBL2) | CSB-YP013540HU

Recombinant Human Mannose-binding protein C (MBL2) | CSB-YP013540HU | Cusabio

Alternative Name(s): Collectin-1MBP1Mannan-binding protein;Mannose-binding lectin

Gene Names: MBL2

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 21-248aa

Sequence Info: Full Length of Mature Protein

MW: 26 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complent pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.

Reference: A human mannose-binding protein is an acute-phase reactant that shares sequence homology with other vertebrate lectins.Ezekowitz R.A.B., Day L.E., Herman G.A.J. Exp. Med. 167:1034-1046(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity: Plasma protein produced mainly in the liver.

Paythway: Complementandcoagulationcascades

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P11226

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM