Cusabio Human Recombinants
Recombinant Human Lymphokine-activated killer T-cell-originated protein kinase (PBK) | CSB-EP822241HUb0
- SKU:
- CSB-EP822241HUb0
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Lymphokine-activated killer T-cell-originated protein kinase (PBK) | CSB-EP822241HUb0 | Cusabio
Alternative Name(s): Cancer/testis antigen 84 MAPKK-like protein kinase Nori-3 PDZ-binding kinase Spermatogenesis-related protein kinase T-LAK cell-originated protein kinase
Gene Names: PBK
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
Source: E.coli
Tag Info: N-terminal 10xHis-tagged
Expression Region: 1-322aa
Sequence Info: Full Length
MW: 42.1 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.
Reference: "Attenuation of DNA damage checkpoint by PBK, a novel mitotic kinase, involves protein-protein interaction with tumor suppressor p53." Nandi A.K., Ford T., Fleksher D., Neuman B., Rapoport A.P. Biochem. Biophys. Res. Commun. 358:181-188(2007)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q96KB5
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A