Cusabio Human Recombinants
Recombinant Human Ly6/PLAUR domain-containing protein 6 (LYPD6) | CSB-EP768237HU
- SKU:
- CSB-EP768237HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Ly6/PLAUR domain-containing protein 6 (LYPD6) | CSB-EP768237HU | Cusabio
Alternative Name(s): LYPD6; UNQ3023/PRO9821Ly6/PLAUR domain-containing protein 6
Gene Names: LYPD6
Research Areas: Neuroscience
Organism: Homo sapiens (Human)
AA Sequence: AQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 23-171aa
Sequence Info: Full Length of Mature Protein
MW: 43.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Acts as a modulator of nicotinic acetylcholine receptors (nAChRs) function in the brain. Inhibits nicotine-induced Ca(2+) influx through nAChRs
Involvement in disease:
Subcellular Location: Secreted, Cytoplasm, Cell membrane, Lipid-anchor, GPI-anchor, Cell junction, synapse, synaptosome, Membrane raft
Protein Families:
Tissue Specificity: Ubiquitous. Highly expressed in brain and heart.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q86Y78
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM