Recombinant Human Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF) | CSB-EP012985HU

(No reviews yet) Write a Review
SKU:
CSB-EP012985HU
Availability:
13 - 23 Working Days
  • Recombinant Human Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF) | CSB-EP012985HU | Cusabio

Alternative Name(s): Small integral membrane protein of lysosome/late endosome p53-induced gene 7 protein

Gene Names: LITAF

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-161aa

Sequence Info: Full Length

MW: 44.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Probable role in regulating transcription of specific genes. May regulate through NFKB1 the expression of the CCL2/MCP-1 chemokine. May play a role in tumor necrosis factor alpha (TNF-alpha) gene expression.

Reference: "A novel lipopolysaccharide-induced transcription factor regulating tumor necrosis factor alpha gene expression: molecular cloning, sequencing, characterization, and chromosomal assignment." Myokai F., Takashiba S., Lebo R., Amar S. Proc. Natl. Acad. Sci. U.S.A. 96:4518-4523(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation

Involvement in disease: Charcot-Marie-Tooth disease 1C (CMT1C)

Subcellular Location: Cytoplasm, Nucleus, Lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Early endosome membrane, Late endosome membrane, Endosome membrane, Peripheral membrane protein, Cytoplasmic side, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Golgi apparatus membrane

Protein Families: CDIP1/LITAF family

Tissue Specificity: Ubiquitously and abundantly expressed. Expressed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99732

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose