Recombinant Human Interleukin-20 receptor subunit beta (IL20RB), partial | CSB-EP740921HU

Recombinant Human Interleukin-20 receptor subunit beta (IL20RB), partial | CSB-EP740921HU | Cusabio

Alternative Name(s): Fibronectin type III domain containing 6 (FNDC6) (IL-20 receptor subunit beta) (IL-20R-beta) (IL-20RB) (IL-20R2) (DIRS1)

Gene Names: IL20RB

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 30-233aa

Sequence Info: Partial

MW: 26.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24.

Reference: "STAT activation by IL-19, IL-20 and mda-7 through IL-20 receptor complexes of two types." Dumoutier L., Leemans C., Lejeune D., Kotenko S.V., Renauld J.-C. J. Immunol. 167:3545-3549(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6UXL0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A