Cusabio Human Recombinants
Recombinant Human Interferon alpha-inducible protein 6 (IFI6) | CSB-EP011016HU
- SKU:
- CSB-EP011016HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Interferon alpha-inducible protein 6 (IFI6) | CSB-EP011016HU | Cusabio
Alternative Name(s): Interferon-induced protein 6-16
Gene Names: IFI6
Research Areas: Cell Biology
Organism: Homo sapiens (Human)
AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE
Source: E.coli
Tag Info: N-terminal 6xHis-B2M-tagged
Expression Region: 24-130aa
Sequence Info: Full Length of Mature Protein
MW: 24.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "Inhibition of G1P3 expression found in the differential display study on respiratory syncytial virus infection." Zhao D., Peng D., Li L., Zhang Q., Zhang C. Virol. J. 5:114-114(2008)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Membrane, Multi-pass membrane protein
Protein Families: IFI6/IFI27 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P09912
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: OMIM