Cusabio Human Recombinants
Recombinant Human Interferon alpha-6 (IFNA6) | CSB-EP011042HU
- SKU:
- CSB-EP011042HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Interferon alpha-6 (IFNA6) | CSB-EP011042HU | Cusabio
Alternative Name(s): Interferon alpha-54 Interferon alpha-K Short name: LeIF K
Gene Names: IFNA6
Research Areas: Cancer
Organism: Homo sapiens (Human)
AA Sequence: SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 21-189aa
Sequence Info: Full Length of Mature Protein
MW: 25.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Reference: "Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes." Janssen R., Bont L., Siezen C.L., Hodemaekers H.M., Ermers M.J., Doornbos G., van 't Slot R., Wijmenga C., Goeman J.J., Kimpen J.L., van Houwelingen H.C., Kimman T.G., Hoebee B. J. Infect. Dis. 196:826-834(2007)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Alpha/beta interferon family
Tissue Specificity:
Paythway: Jak-STATsignalingpathway
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P05013
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM