Recombinant Human Interferon alpha-14 (IFNA14) | CSB-YP011035HU

(No reviews yet) Write a Review
SKU:
CSB-YP011035HU
Availability:
25 - 35 Working Days
  • Recombinant Human Interferon alpha-14 (IFNA14)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€262.00 - €943.00

Description

Recombinant Human Interferon alpha-14 (IFNA14) | CSB-YP011035HU | Cusabio

Alternative Name(s): Interferon alpha-H ;LeIF HInterferon lambda-2-H

Gene Names: IFNA14

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-189aa

Sequence Info: Full Length of Mature Protein

MW: 21.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Reference: The structure of eight distinct cloned human leukocyte interferon cDNAs.Goeddel D.V., Leung D.W., Dull T.J., Gross M., Lawn R.M., McCandliss R., Seeburg P.H., Ullrich A., Yelverton E., Gray P.W.Nature 290:20-26(1981)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Alpha/beta interferon family

Tissue Specificity:

Paythway: Jak-STATsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01570

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose