Cusabio Other Organism Recombinants
Recombinant Human immunodeficiency virus type 2 subtype A Protein Vpx (vpx) | CSB-EP325553HLU
- SKU:
- CSB-EP325553HLU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human immunodeficiency virus type 2 subtype A Protein Vpx (vpx) | CSB-EP325553HLU | Cusabio
Alternative Name(s): Viral protein XX ORF protein
Gene Names: vpx
Research Areas: Others
Organism: Human immunodeficiency virus type 2 subtype A (isolate BEN) (HIV-2)
AA Sequence: MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-113aa
Sequence Info: Full Length
MW: 17.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.
Reference: The Vpx lentiviral accessory protein targets SAMHD1 for degradation in the nucleus.Hofmann H., Logue E.C., Bloch N., Daddacha W., Polsky S.B., Schultz M.L., Kim B., Landau N.R.J. Virol. 86:12552-12560(2012)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.
Involvement in disease:
Subcellular Location: Virion, Host nucleus
Protein Families: Lentivirus VPX protein family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P18099
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A