Recombinant Human Hyaluronan and proteoglycan link protein 4 (HAPLN4) | CSB-EP010133HU

Recombinant Human Hyaluronan and proteoglycan link protein 4 (HAPLN4) | CSB-EP010133HU | Cusabio

Alternative Name(s): Brain link protein 2 (BRAL2) (KIAA1926)

Gene Names: HAPLN4

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLGFPDATRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLHV

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 30-402aa

Sequence Info: Full Length of Mature Protein

MW: 43.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Binds to hyaluronic acid and may be involved in formation of the extracellular matrix.

Reference: "Candidate gene analysis of the human natural killer-1 carbohydrate pathway and perineuronal nets in schizophrenia: B3GAT2 is associated with disease risk and cortical surface area." Kahler A.K., Djurovic S., Rimol L.M., Brown A.A., Athanasiu L., Jonsson E.G., Hansen T., Gustafsson O., Hall H., Giegling I., Muglia P., Cichon S., Rietschel M., Pietilainen O.P., Peltonen L., Bramon E., Collier D., St Clair D. Andreassen O.A. Biol. Psychiatry 69:90-96(2011) [

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q86UW8

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A