Recombinant Human Hyaluronan and proteoglycan link protein 2 (HAPLN2) | CSB-BP010131HU

(No reviews yet) Write a Review
SKU:
CSB-BP010131HU
Availability:
28 - 38 Working Days
€443.00 - €1,472.00

Description

Recombinant Human Hyaluronan and proteoglycan link protein 2 (HAPLN2) | CSB-BP010131HU | Cusabio

Alternative Name(s): Brain link protein 1 (BRAL1)

Gene Names: HAPLN2

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged

Expression Region: 27-340aa

Sequence Info: Full Length of Mature Protein

MW: 37.2

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Mediates a firm binding of versican V2 to hyaluronic acid. May play a pivotal role in the formation of the hyaluronan-associated matrix in the central nervous system which facilitates neuronal conduction and general structural stabilization. Binds to hyaluronic acid.

Reference: "Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis." Martins-de-Souza D., Gattaz W.F., Schmitt A., Rewerts C., Marangoni S., Novello J.C., Maccarrone G., Turck C.W., Dias-Neto E. J Neural Transm (Vienna) 116:275-289(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9GZV7

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose