Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial | CSB-YP008532HU

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial | CSB-YP008532HU | Cusabio

Alternative Name(s): Fc-epsilon RI-alpha Short name: FcERI IgE Fc receptor subunit alpha

Gene Names: FCER1A

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 26-205aa

Sequence Info: Extracellular Domain

MW: 23 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.

Reference: "High-level expression of the truncated alpha chain of human high-affinity receptor for IgE as a soluble form by baculovirus-infected insect cells. Biochemical characterization of the recombinant product."Yagi S., Yanagida M., Tanida I., Hasegawa A., Okumura K., Ra C.Eur. J. Biochem. 220:593-598(1994).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity:

Paythway: FcepsilonRIsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P12319

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM