Recombinant Human GTP-binding protein Di-Ras3 (DIRAS3) | CSB-EP006907HU

Recombinant Human GTP-binding protein Di-Ras3 (DIRAS3) | CSB-EP006907HU | Cusabio

Alternative Name(s): Distinct subgroup of the Ras family member 3 Rho-related GTP-binding protein RhoI

Gene Names: DIRAS3

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-229aa

Sequence Info: Full Length

MW: 52.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "NOEY2 (ARHI), an imprinted putative tumor suppressor gene in ovarian and breast carcinomas." Yu Y.H., Xu F.J., Peng H., Fang X., Zhao S., Li Y., Cuevas B., Kuo W.-L., Gray J.W., Siciliano M., Mills G.B., Bast R.C. Jr. Proc. Natl. Acad. Sci. U.S.A. 96:214-219(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, Cytoplasmic side

Protein Families: Small GTPase superfamily, Di-Ras family

Tissue Specificity: Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O95661

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM