Cusabio Human Recombinants
Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1) | CSB-EP875707HU
- SKU:
- CSB-EP875707HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1) | CSB-EP875707HU | Cusabio
Alternative Name(s): HMGE Mt-GrpE#1
Gene Names: GRPEL1
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-217aa
Sequence Info: Full Length
MW: 48.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins.
Reference: "Identification and characterization of a human mitochondrial homologue of the bacterial co-chaperone GrpE." Choglay A.A., Chapple J.P., Blatch G.L., Cheetham M.E. Gene 267:125-134(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner (By similarity). Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins
Involvement in disease:
Subcellular Location: Mitochondrion matrix
Protein Families: GrpE family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9HAV7
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM