Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial (Active) | CSB-AP003591HU

(No reviews yet) Write a Review
SKU:
CSB-AP003591HU
Availability:
5 to 10 Working Days
  • Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA) ,partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€213.00 - €414.00

Description

Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA) ,partial (Active) | CSB-AP003591HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; GM-CSF-R-Alpha; GMCSFR-Alpha; GMR-Alpha; CDw116; CD116; CSF2RA; CSF2R; CSF2RY

Gene Names: CSF2RA

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal 6xHis-tagged

Expression Region: 23-320aa

Sequence Info: EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Biological Activity: The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF‑1 human erythroleukemic cells is less than 5 ng/ml.

MW: 35.5 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit α (CSF2RA) is a single-pass type I membrane protein which belongs to the type I cytokine receptor family of Type 5 subfamily. The CSF2RA gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes with some of the isoforms being membrane-bound and others being soluble. CSF2RA is a low affinity receptor for granulocyte-macrophage colony-stimulating factor. CSF2RA transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4) .

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.

Involvement in disease: Pulmonary surfactant metabolism dysfunction 4 (SMDP4)

Subcellular Location: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted

Protein Families: Type I cytokine receptor family, Type 5 subfamily

Tissue Specificity:

Paythway: Jak-STATsignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15509

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose