Cusabio Human Recombinants
Recombinant Human Glypican-6 (GPC6) | CSB-YP009708HU
- SKU:
 - CSB-YP009708HU
 - Availability:
 - 25 - 35 Working Days
 
Description
Recombinant Human Glypican-6 (GPC6) | CSB-YP009708HU | Cusabio
Alternative Name(s): GPC 6; Glypican 6 [Precursor]; Glypican proteoglycan 6; Gpc6; GPC6_HUMAN; MGC126288 ; OMIMD1; PRO705; Secreted glypican 6; Secreted glypican-6; UNQ369
Gene Names: GPC6
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: DVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDS
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 24-529aa
Sequence Info: Full Length of Mature Protein
MW: 59.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, Extracellular domain matrix proteins, proteases and anti-proteases . Enhances migration and invasion of cancer cells through WNT5A signaling.1 Publication
Reference: GPC6, a novel member of the glypican gene family, encodes a product structurally related to GPC4 and is colocalized with GPC5 on human chromosome 13.Paine-Saunders S., Viviano B.L., Saunders S.Genomics 57:455-458(1999)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases (By similarity). Enhances migration and invasion of cancer cells through WNT5A signaling.
Involvement in disease: Omodysplasia 1 (OMOD1)
Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor, Extracellular side, SUBCELLULAR LOCATION: Secreted glypican-6: Secreted, extracellular space
Protein Families: Glypican family
Tissue Specificity: Widely expressed. High expression in fetal kidney and lung and lower expressions in fetal liver and brain. In adult tissues, very abundant in ovary, high levels also observed in liver, kidney, small intestine and colon. Not detected in peripheral blood leukocytes. Detected in breast cancer cells (at protein level).
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9Y625
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM