Cusabio Human Recombinants
Recombinant Human Glutathione S-transferase P (GSTP1) | CSB-YP009989HUb0
- SKU:
- CSB-YP009989HUb0
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Glutathione S-transferase P (GSTP1) | CSB-YP009989HUb0 | Cusabio
Alternative Name(s): GST class-piGSTP1-1
Gene Names: GSTP1
Research Areas: Metabolism
Organism: Homo sapiens (Human)
AA Sequence: PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Source: Yeast
Tag Info: N-terminal 10xHis-tagged
Expression Region: 2-210aa
Sequence Info: Full Length of Mature Protein
MW: 25.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Reference: Structure and expression of a human class pi glutathione S-transferase messenger RNA.Kano T., Sakai M., Muramatsu M.Cancer Res. 47:5626-5630(1987)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Involvement in disease:
Subcellular Location: Cytoplasm, Mitochondrion, Nucleus
Protein Families: GST superfamily, Pi family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P09211
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM