Cusabio Human Recombinants
Recombinant Human Glutaredoxin-1 (GLRX) | CSB-EP009521HU
- SKU:
- CSB-EP009521HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Glutaredoxin-1 (GLRX) | CSB-EP009521HU | Cusabio
Alternative Name(s): Thioltransferase-1 ;TTase-1
Gene Names: GLRX
Research Areas: Transport
Organism: Homo sapiens (Human)
AA Sequence: MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-106aa
Sequence Info: Full Length
MW: 38.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.
Reference: Cloning and sequencing of the cDNA encoding human glutaredoxin.Fernando M.R., Sumimoto H., Nanri H., Kawabata S., Iwanaga S., Minakami S., Fukumaki Y., Takeshige K.Biochim. Biophys. Acta 1218:229-231(1994)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: Glutaredoxin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P35754
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM