Recombinant Human Glutamate receptor ionotropic, NMDA 1 (GRIN1), partial | CSB-EP009911HU1

Recombinant Human Glutamate receptor ionotropic, NMDA 1 (GRIN1), partial | CSB-EP009911HU1 | Cusabio

Alternative Name(s): Glutamate [NMDA] receptor subunit zeta-1 (N-methyl-D-aspartate receptor subunit NR1) (NMD-R1) (GluN1) (NMDAR1)

Gene Names: GRIN1

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: EIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 834-938aa

Sequence Info: Partial

MW: 18.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg2+. Sensitivity to glutamate and channel kinetics depend on the subunit composition.

Reference: "Molecular cloning, functional expression, and pharmacological characterization of an N-methyl-D-aspartate receptor subunit from human brain." Planells-Cases R., Sun W., Ferrer-Montiel A.V., Montal M. Proc. Natl. Acad. Sci. U.S.A. 90:5057-5061(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q05586

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A