Cusabio Human Recombinants
Recombinant Human G-protein coupled receptor 157 (GPR157) | CSB-CF713185HU
- SKU:
- CSB-CF713185HU
- Availability:
- 18 - 23 Working Days
Description
Recombinant Human G-protein coupled receptor 157 (GPR157) | CSB-CF713185HU | Cusabio
Alternative Name(s): GPR157G-protein coupled receptor 157
Gene Names: GPR157
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST
Source: in vitro E.coli expression system
Tag Info: N-terminal 10xHis-tagged
Expression Region: 1-335aa
Sequence Info: Full Length
MW: 39.4 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Orphan receptor that promotes neuronal differentiation of radial glial progenitors (RGPs). The activity of this receptor is mediated by a G(q)-protein that activates a phosphatidylinositol-calcium second messenger.
Reference: "Complete coding sequence of GPR157." Bonner T.I., Kauffman D., Nagle J.W. Submitted (SEP-2004)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Orphan receptor that promotes neuronal differentiation of radial glial progenitors (RGPs). The activity of this receptor is mediated by a G(q)-protein that activates a phosphatidylinositol-calcium second messenger.
Involvement in disease:
Subcellular Location: Cell projection, cilium membrane, Multi-pass membrane protein
Protein Families: G-protein coupled receptor 2 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q5UAW9
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A