Recombinant Human Ficolin-2 (FCN2) | CSB-YP620881HU

Recombinant Human Ficolin-2 (FCN2) | CSB-YP620881HU | Cusabio

Alternative Name(s): 37KDA elastin-binding protein Collagen/fibrinogen domain-containing protein 2 EBP-37 Ficolin-B Ficolin-beta Hucolin L-ficolin Serum lectin p35

Gene Names: FCN2

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 26-313aa

Sequence Info: Full Length of Mature Protein

MW: 33.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region.

Reference: "A novel human serum lectin with collagen- and fibrinogen-like domains that functions as an opsonin." Matsushita M., Endo Y., Taira S., Sato Y., Fujita T., Ichikawa N., Nakata M., Mizuochi T.J. Biol. Chem. 271:2448-2454(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Ficolin lectin family

Tissue Specificity: Expressed by the liver and secreted in plasma.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q15485

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM