Recombinant Human Fibronectin type III domain-containing protein 5 (FNDC5), partial | CSB-EP836707HU

(No reviews yet) Write a Review
SKU:
CSB-EP836707HU
Availability:
3 - 7 Working Days
  • Recombinant Human Fibronectin type III domain-containing protein 5 (FNDC5), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Fibronectin type III domain-containing protein 5 (FNDC5), partial | CSB-EP836707HU | Cusabio

Alternative Name(s): Fibronectin type III repeat-containing protein 2

Gene Names: FNDC5

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 32-143aa

Sequence Info: Partial

MW: 28.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Irisin: Contrary to mouse, may not be involved in the beneficial effects of muscular exercise, nor in the induction of browning of human white adipose tissue.

Reference: "Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Irisin

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein, Peroxisome membrane, Single-pass type I membrane protein, Note=Imported in peroxisomes through the PEX5 receptor pathway, SUBCELLULAR LOCATION: Irisin: Secreted

Protein Families:

Tissue Specificity: Widely expressed, with highest levels in heart. Very low expression, if any, in colon, pancreas and spleen.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8NAU1

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose